<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31656
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAMLLNQSQPPQGREGGGTQVGSLGPGIPVGQQQQQLGLQQQQQDFDPVQRYRMLIPQLKESLQNLMKIAAQNLVQNTNIDNGQKNADGLVQRFDKSLEEFYAICDQLELCLRLAYECLSQSYDSAKHSPTLVPTATKPDAVQTESLPYTQYLSMIKSQISCAKDIHNALLECSKKIMGKTPNTQGGL |
Length | 188 |
Position | Tail |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Silurana.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.509 |
Instability index | 56.16 |
Isoelectric point | 6.10 |
Molecular weight | 20767.42 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31656
No repeats found
No repeats found
|