| Description | Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
| Length | 200 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.366 |
| Instability index | 69.14 |
| Isoelectric point | 5.86 |
| Molecular weight | 21072.64 |
| Publications | PubMed=15555573 PubMed=14702039 PubMed=17974005 PubMed=15057824 PubMed=15489334 PubMed=14576168 PubMed=14638676 PubMed=15175163 PubMed=15989967 PubMed=19413330 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000269 PubMed:15555573 |
| GO - Cellular Component | mediator complex GO:0016592 IDA:MGI nucleoplasm GO:0005654 IDA:HPA |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions | [Q9NX70<-->Q9NYB9-2: ABI2] NbExp=3 EBI-394656,EBI-11096309 [Q9NX70<-->Q9P2A4: ABI3] NbExp=3 EBI-394656,EBI-742038 [Q9NX70<-->O75934: BCAS2] NbExp=3 EBI-394656,EBI-1050106 [Q9NX70<-->Q14232: EIF2B1] NbExp=3 EBI-394656,EBI-491065 [Q9NX70<-->Q9BUE0: MED18] NbExp=6 EBI-394656,EBI-394640 [Q9NX70<-->A0JLT2: MED19] NbExp=8 EBI-394656,EBI-394430 [Q9NX70<-->Q9H944: MED20] NbExp=6 EBI-394656,EBI-394644 [Q9NX70<-->Q15528: MED22] NbExp=4 EBI-394656,EBI-394687 [Q9NX70<-->Q9H204: MED28] NbExp=3 EBI-394656,EBI-514199 [Q9NX70<-->O75586: MED6] NbExp=3 EBI-394656,EBI-394624 [Q9NX70<-->Q9H7Z3: NRDE2] NbExp=3 EBI-394656,EBI-1042642 [Q9NX70<-->A1L4H1: SSC5D] NbExp=3 EBI-394656,EBI-10172867 [Q9NX70<-->Q9D8C6: Med11] Xeno NbExp=2, [Q9NX70<-->Q9R0X0: Med20] Xeno NbExp=2, [Q9NX70<-->Q9CQI9: Med30] Xeno NbExp=2, [Q9NX70<-->Q9D7W5: Med8] Xeno NbExp=2, |
| Repeats |
>MDP31653
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.26| 14| 167| 14| 27| 1
---------------------------------------------------------------------------
14- 27 (26.59/11.46) AAGVSG..PSSAGGPG
182- 197 (22.67/ 8.86) ANKVTGktPAPPAGPG
---------------------------------------------------------------------------
|
| Disease |
| MoRF Sequence | Start | Stop |
| 1) MAASQQQASAASSAA | 1 | 15 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab