<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31651

Description Mediator of RNA polymerase II transcription subunit 29
SequenceMNPNMNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNISQAD
Length188
PositionTail
OrganismDrosophila melanogaster (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.05
Grand average of hydropathy-0.631
Instability index74.73
Isoelectric point6.42
Molecular weight21146.84
Publications
PubMed=12361959
PubMed=10731132
PubMed=12537572

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for female somatic sexual development. 
ECO:0000250	
ECO:0000269	PubMed:12361959
GO - Cellular Component
mediator complex	GO:0016592	IDA:UniProtKB
GO - Biological Function
transcription coregulator activity	GO:0003712	IDA:UniProtKB
transcription factor binding	GO:0008134	IPI:FlyBase
GO - Biological Process
cell differentiation	GO:0030154	IEA:UniProtKB-KW
female somatic sex determination	GO:0019101	TAS:FlyBase
genital disc sexually dimorphic development	GO:0035263	IMFlyBase
imaginal disc-derived female genitalia morphogenesis	GO:0048804	IMFlyBase
negative regulation of cell death	GO:0060548	IMFlyBase
regulation of transcription by RNA polymerase II	GO:0006357	IDA:UniProtKB
sex determination	GO:0007530	IMFlyBase
sex differentiation	GO:0007548	TAS:FlyBase
somatic sex determination	GO:0018993	NAS:FlyBase

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.41|      17|     123|       2|      30|       1
---------------------------------------------------------------------------
   14-   30 (34.88/27.73)	QMMQVMQSSPSGPPGPV
  122-  138 (34.54/ 8.07)	QCLQQQNSSNHYLPGPV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31651 with Med29 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNPNMNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQQAEKLDNISRV
1
56










Molecular Recognition Features






MoRF SequenceStartStop




NANANA