<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31651
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MNPNMNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNISQAD |
| Length | 188 |
| Position | Tail |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.631 |
| Instability index | 74.73 |
| Isoelectric point | 6.42 |
| Molecular weight | 21146.84 |
| Publications | PubMed=12361959
PubMed=10731132
PubMed=12537572
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Required for
female somatic sexual development.
|
| GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IDA:UniProtKB
transcription factor binding GO:0008134 IPI:FlyBase
|
| GO - Biological Process | cell differentiation GO:0030154 IEA:UniProtKB-KW
female somatic sex determination GO:0019101 TAS:FlyBase
genital disc sexually dimorphic development GO:0035263 IMFlyBase
imaginal disc-derived female genitalia morphogenesis GO:0048804 IMFlyBase
negative regulation of cell death GO:0060548 IMFlyBase
regulation of transcription by RNA polymerase II GO:0006357 IDA:UniProtKB
sex determination GO:0007530 IMFlyBase
sex differentiation GO:0007548 TAS:FlyBase
somatic sex determination GO:0018993 NAS:FlyBase
|
Interaction
Repeat regions
| Repeats |
>MDP31651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.41| 17| 123| 2| 30| 1
---------------------------------------------------------------------------
14- 30 (34.88/27.73) QMMQVMQSSPSGPPGPV
122- 138 (34.54/ 8.07) QCLQQQNSSNHYLPGPV
---------------------------------------------------------------------------
|