<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31649
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MSGQGPPPSMTPQQQHMLMQQQQQQQMMRQQQMQQQQMQQQRQQQIQQQAQQPYQRARTPQMVPQGGSPGGAHLQMHPHLQPQGQMQPRSPLVGAQLQAPSSVPTAANPTTPQMMQQQMGMNQPMSLPPTHVSRPGSVAPPSSVPVNLQHTSGAPGLPGSQMEHQYPMHLQPQQQTLSRPGSQQSQHIQQPGSIQRPGSVLAPGSIPPGGPASQTGPQSIQVFGPGSVQPPGSTQAPSSVQPASTFNPGSIQAPASQQPPASVQPPPSAASGSTVAGAQSSKEPLKPNEEQIRMVQDPVDLVRNLVQKDLRNSLVEMNKRGAELVRQKQEGEVNEDGKAQYSRATNDFHAVCDEIDRTLTTVLETAKQLSKLDKVFFDRSSRDLDGEVMVNSVQNFVDNTEIVQRMFDDTIGSVTSSMESMRRRQKKWEDQHKNDDVEMME |
| Length | 441 |
| Position | Tail |
| Organism | Caenorhabditis elegans |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.899 |
| Instability index | 73.15 |
| Isoelectric point | 6.84 |
| Molecular weight | 48285.52 |
| Publications | PubMed=9851916
PubMed=15020414
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleus GO:0005634 ISS:WormBase
|
| GO - Biological Function | DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000981 IBA:GO_Central
RNA polymerase II transcription regulatory region sequence-specific DNA binding GO:0000977 IBA:GO_Central
|
| GO - Biological Process | lateral inhibition GO:0046331 IGI:WormBase
positive regulation of Notch signaling pathway GO:0045747 IGI:WormBase
regulation of cell fate specification GO:0042659 IGI:WormBase
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31649
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 127.06| 20| 20| 223| 242| 1
---------------------------------------------------------------------------
106- 129 (28.54/ 6.40) AAnpttPQMMQQQMGMNQPMSLP.P
133- 150 (28.03/ 6.13) SR....PGSVAPPSS..VPVNLQ.H
178- 197 (29.52/ 6.92) SR....PGS.QQSQHIQQPGSIQrP
223- 242 (40.97/13.02) FG....PGSVQPPGSTQAPSSVQ.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.86| 16| 42| 199| 221| 3
---------------------------------------------------------------------------
60- 77 (23.89/10.83) P...Q......................MVPQGGSpgGAHLQMH
217- 259 ( 8.97/ 6.94) PqsiQvfgpgsvqppgstqapssvqpaSTFNPGSiqAPASQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.61| 10| 54| 152| 161| 4
---------------------------------------------------------------------------
152- 161 (20.48/ 9.15) SGAPGLPGSQ
205- 214 (21.12/ 9.68) SIPPGGPASQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 163.16| 51| 54| 330| 383| 5
---------------------------------------------------------------------------
330- 383 (76.32/82.87) EGEVNEDGKAQYSRATNdfhAVCDEIDRTLTTVLETAKQLSKLDKVFFDRSSRD
385- 435 (86.84/81.27) DGEVMVNSVQNFVDNTE...IVQRMFDDTIGSVTSSMESMRRRQKKWEDQHKND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.83| 12| 15| 30| 42| 6
---------------------------------------------------------------------------
30- 42 (20.04/ 9.60) QQQmQQQQMQQQR
47- 58 (22.78/ 7.00) QQQ.AQQPYQRAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.84| 13| 20| 292| 304| 7
---------------------------------------------------------------------------
292- 304 (22.40/15.58) IRMVQDPVDLVRN
315- 327 (21.44/14.60) VEMNKRGAELVRQ
---------------------------------------------------------------------------
|