Description | Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MSGQGPPPSMTPQQQHMLMQQQQQQQMMRQQQMQQQQMQQQRQQQIQQQAQQPYQRARTPQMVPQGGSPGGAHLQMHPHLQPQGQMQPRSPLVGAQLQAPSSVPTAANPTTPQMMQQQMGMNQPMSLPPTHVSRPGSVAPPSSVPVNLQHTSGAPGLPGSQMEHQYPMHLQPQQQTLSRPGSQQSQHIQQPGSIQRPGSVLAPGSIPPGGPASQTGPQSIQVFGPGSVQPPGSTQAPSSVQPASTFNPGSIQAPASQQPPASVQPPPSAASGSTVAGAQSSKEPLKPNEEQIRMVQDPVDLVRNLVQKDLRNSLVEMNKRGAELVRQKQEGEVNEDGKAQYSRATNDFHAVCDEIDRTLTTVLETAKQLSKLDKVFFDRSSRDLDGEVMVNSVQNFVDNTEIVQRMFDDTIGSVTSSMESMRRRQKKWEDQHKNDDVEMME |
Length | 441 |
Position | Tail |
Organism | Caenorhabditis elegans |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.899 |
Instability index | 73.15 |
Isoelectric point | 6.84 |
Molecular weight | 48285.52 |
Publications | PubMed=9851916 PubMed=15020414 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro nucleus GO:0005634 ISS:WormBase |
GO - Biological Function | DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000981 IBA:GO_Central RNA polymerase II transcription regulatory region sequence-specific DNA binding GO:0000977 IBA:GO_Central |
GO - Biological Process | lateral inhibition GO:0046331 IGI:WormBase positive regulation of Notch signaling pathway GO:0045747 IGI:WormBase regulation of cell fate specification GO:0042659 IGI:WormBase regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31649 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 127.06| 20| 20| 223| 242| 1 --------------------------------------------------------------------------- 106- 129 (28.54/ 6.40) AAnpttPQMMQQQMGMNQPMSLP.P 133- 150 (28.03/ 6.13) SR....PGSVAPPSS..VPVNLQ.H 178- 197 (29.52/ 6.92) SR....PGS.QQSQHIQQPGSIQrP 223- 242 (40.97/13.02) FG....PGSVQPPGSTQAPSSVQ.P --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.86| 16| 42| 199| 221| 3 --------------------------------------------------------------------------- 60- 77 (23.89/10.83) P...Q......................MVPQGGSpgGAHLQMH 217- 259 ( 8.97/ 6.94) PqsiQvfgpgsvqppgstqapssvqpaSTFNPGSiqAPASQQP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.61| 10| 54| 152| 161| 4 --------------------------------------------------------------------------- 152- 161 (20.48/ 9.15) SGAPGLPGSQ 205- 214 (21.12/ 9.68) SIPPGGPASQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 163.16| 51| 54| 330| 383| 5 --------------------------------------------------------------------------- 330- 383 (76.32/82.87) EGEVNEDGKAQYSRATNdfhAVCDEIDRTLTTVLETAKQLSKLDKVFFDRSSRD 385- 435 (86.84/81.27) DGEVMVNSVQNFVDNTE...IVQRMFDDTIGSVTSSMESMRRRQKKWEDQHKND --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.83| 12| 15| 30| 42| 6 --------------------------------------------------------------------------- 30- 42 (20.04/ 9.60) QQQmQQQQMQQQR 47- 58 (22.78/ 7.00) QQQ.AQQPYQRAR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.84| 13| 20| 292| 304| 7 --------------------------------------------------------------------------- 292- 304 (22.40/15.58) IRMVQDPVDLVRN 315- 327 (21.44/14.60) VEMNKRGAELVRQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MTPQQ 2) PYQRARTPQMVP | 10 53 | 14 64 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab