<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31648
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MSGQGPPSNLTPQQQHMIMQQQQQQQMMRQQQIQQQQLHQRQLQQQQAQQSYQRSRTPQMQQHPGGGSPGSHLQMHPHLQSQGHMQPRSPLVGQHHPAPGSIPPGNPATPQMMQQQMGMNQPMSLPAPHVSRPGSVAPPASVPPNMHTGPSSNQMDQMGGQSQYSHHLQPQQPLSRPGSQQSHIAGGHGGPHSVQQPGSVLAPGSIQQPGSLLAPGSMHQPGSVQQPGSLGAPLSHTGAGGPQSVQGYGPGSVQPPGSAQAPSSVQPGSTFAPGSLQAPASQQPPASIQPPPSAASGSVAGPASAAPAKVEPLKPNEEQIRMVQDPVDLVRNLVQKDLRMSVVEMNKRGAELLHQKEEGAIKEEDRQQYKRATNDFHAVCDEIDRTLTTIMETAKQITKLDKVFQDRTSKEIDGEAMVNSVQKFVDETGIVQKMFDDTVNSVTSTMEKMRRRQKKWKDQQQQQENAEDAEMAE |
| Length | 473 |
| Position | Tail |
| Organism | Caenorhabditis briggsae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.920 |
| Instability index | 74.69 |
| Isoelectric point | 7.39 |
| Molecular weight | 51146.58 |
| Publications | PubMed=14624247
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000981 IBA:GO_Central
RNA polymerase II transcription regulatory region sequence-specific DNA binding GO:0000977 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.62| 16| 16| 197| 212| 1
---------------------------------------------------------------------------
191- 208 (26.82/ 7.83) PHSVqqPGSVLAPGSIQQ
209- 226 (30.03/ 9.79) PGSLlaPGSMHQPGSVQQ
273- 290 (25.77/ 7.19) PGSLqaPASQQPPASIQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.10| 16| 18| 60| 77| 2
---------------------------------------------------------------------------
60- 77 (27.44/14.65) MQQHPGGGSPGShLQmHP
113- 128 (29.67/ 8.37) MQQQMGMNQPMS.LP.AP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.29| 21| 21| 401| 421| 7
---------------------------------------------------------------------------
394- 414 (31.03/25.96) AKQITKL..........DKVFQDRT...SKEIDG
415- 437 (28.39/23.00) EAMVNSV..........QK.FVDETgivQKMFDD
438- 466 (16.86/10.08) ..TVNSVtstmekmrrrQKKWKDQQ...QQQENA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.13| 15| 22| 347| 366| 9
---------------------------------------------------------------------------
347- 366 (19.96/30.28) KRGAELLHqkeegAIKEE.DR
370- 385 (24.17/18.61) KRATNDFH.....AVCDEiDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.24| 14| 56| 253| 267| 12
---------------------------------------------------------------------------
253- 267 (23.81/13.27) VQPPGSAqAPSSVQP
299- 312 (24.43/ 8.92) VAGPASA.APAKVEP
---------------------------------------------------------------------------
|