<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31645
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MMNQMGMMMQQQGVGVPGGPGGVGGVGMPGPGGVGVAPGMMQSPQMQQAQQQQVQQQQVQQQQVQQQQVQQQQQQVQQQQQQQQQHSQSAQQQAQQTEKVDNISKVKVLVGPLRDALSTTIKTAAQLIQQNTLADAGSKTVDLNNAPRFDKHLEEFYSICDQIELNLKTTKLCMQQCTSSQQYLPIPVATSQPPLPETNALTYNQYLEVVKLQIGYAKDIHDTLICAAQNISPSE |
| Length | 235 |
| Position | Tail |
| Organism | Anopheles gambiae (African malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.625 |
| Instability index | 65.36 |
| Isoelectric point | 5.56 |
| Molecular weight | 25781.82 |
| Publications | PubMed=12364791
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31645
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.88| 14| 17| 13| 28| 2
---------------------------------------------------------------------------
13- 28 (23.42/15.79) GVGVpgGPGGVGGVGM
33- 46 (28.45/12.77) GVGV..APGMMQSPQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.92| 18| 31| 88| 105| 3
---------------------------------------------------------------------------
88- 105 (28.25/11.24) QSAQQQAQQTEKVDNISK
122- 139 (24.67/ 8.80) KTAAQLIQQNTLADAGSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 101.50| 32| 51| 145| 179| 5
---------------------------------------------------------------------------
145- 179 (52.69/54.49) NAPRFDKHLEefySICDQI..ELNLKTTKLCMQQCTS
199- 232 (48.81/39.52) NALTYNQYLE...VVKLQIgyAKDIHDTLICAAQNIS
---------------------------------------------------------------------------
|