<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31642
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAASLGGMFAGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAYLEQASANIPAPLKQT |
| Length | 178 |
| Position | Head |
| Organism | Rattus norvegicus (Rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Rattus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.467 |
| Instability index | 63.87 |
| Isoelectric point | 5.38 |
| Molecular weight | 19523.95 |
| Publications | PubMed=15057822
PubMed=12149480
|
Function
| Annotated function |
May be part of a complex containing NF2/merlin that
participates in cellular signaling to the actin cytoskeleton downstream
of tyrosine kinase signaling pathways (By similarity). Component of the
Mediator complex, a coactivator involved in the regulated transcription
of nearly all RNA polymerase II-dependent genes. Mediator functions as
a bridge to convey information from gene-specific regulatory proteins
to the basal RNA polymerase II transcription machinery. Mediator is
recruited to promoters by direct interactions with regulatory proteins
and serves as a scaffold for the assembly of a functional preinitiation
complex with RNA polymerase II and the general transcription factors.
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 ISO:RGD
cytoskeleton GO:0005856 ISO:RGD
mediator complex GO:0016592 ISO:RGD
membrane GO:0016020 IEA:UniProtKB-SubCell
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | actin binding GO:0003779 IEA:UniProtKB-KW
|
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 ISO:RGD
stem cell population maintenance GO:0019827 ISO:RGD
|
Interaction
Repeat regions
| Repeats |
>MDP31642
No repeats found
|