<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31641
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MAASLGGMFTGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAFLEQASANIPAPLKQT |
Length | 178 |
Position | Head |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.458 |
Instability index | 63.39 |
Isoelectric point | 5.38 |
Molecular weight | 19537.97 |
Publications | PubMed=16141072
PubMed=15489334
PubMed=21183079
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. May be part of a complex
containing NF2/merlin that participates in cellular signaling to the
actin cytoskeleton downstream of tyrosine kinase signaling pathways (By
similarity).
ECO:0000250
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IDA:MGI
cytoskeleton GO:0005856 IDA:MGI
mediator complex GO:0016592 IDA:MGI
membrane GO:0016020 IEA:UniProtKB-SubCell
nucleoplasm GO:0005654 ISO:MGI
|
GO - Biological Function | actin binding GO:0003779 IEA:UniProtKB-KW
|
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IMMGI
stem cell population maintenance GO:0019827 IMMGI
|
Interaction
Repeat regions
Repeats |
>MDP31641
No repeats found
|