| Description | Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 178 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.452 |
| Instability index | 61.27 |
| Isoelectric point | 5.39 |
| Molecular weight | 19519.94 |
| Publications | PubMed=11779215 PubMed=15489334 PubMed=15175163 PubMed=15467741 PubMed=15989967 PubMed=21269460 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. May be part of a complex
containing NF2/merlin that participates in cellular signaling to the
actin cytoskeleton downstream of tyrosine kinase signaling pathways.
ECO:0000269 PubMed:15467741 |
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl mediator complex GO:0016592 IBA:GO_Central membrane GO:0016020 IEA:UniProtKB-SubCell nucleoplasm GO:0005654 IDA:HPA |
| GO - Biological Function | actin binding GO:0003779 IEA:UniProtKB-KW |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl stem cell population maintenance GO:0019827 IEA:Ensembl |
| Binary Interactions | [Q9H204<-->Q8NA61: CBY2] NbExp=3 EBI-514199,EBI-741724 [Q9H204<-->Q8NA61-2: CBY2] NbExp=3 EBI-514199,EBI-11524851 [Q9H204<-->P26378-2: ELAVL4] NbExp=3 EBI-514199,EBI-21603100 [Q9H204<-->P06241: FYN] NbExp=6 EBI-514199,EBI-515315 [Q9H204<-->P62993: GRB2] NbExp=3 EBI-514199,EBI-401755 [Q9H204<-->P42858: HTT] NbExp=9 EBI-514199,EBI-466029 [Q9H204<-->P06239: LCK] NbExp=4 EBI-514199,EBI-1348 [Q9H204<-->Q5TCQ9: MAGI3] NbExp=2 EBI-514199,EBI-310506 [Q9H204<-->Q9NVC6: MED17] NbExp=2 EBI-514199,EBI-394562 [Q9H204<-->Q15528: MED22] NbExp=2 EBI-514199,EBI-394687 [Q9H204<-->Q9NX70: MED29] NbExp=3 EBI-514199,EBI-394656 [Q9H204<-->Q96HR3: MED30] NbExp=6 EBI-514199,EBI-394659 [Q9H204<-->Q5JXC2: MIIP] NbExp=3 EBI-514199,EBI-2801965 [Q9H204<-->Q92597: NDRG1] NbExp=3 EBI-514199,EBI-716486 [Q9H204<-->P35240: NF2] NbExp=4 EBI-514199,EBI-1014472 [Q9H204<-->P35240-1: NF2] NbExp=2 EBI-514199,EBI-1014500 [Q9H204<-->Q96LA8: PRMT6] NbExp=2 EBI-514199,EBI-912440 [Q9H204<-->Q9UHX1: PUF60] NbExp=6 EBI-514199,EBI-1053259 [Q9H204<-->P12931: SRC] NbExp=3 EBI-514199,EBI-621482 [Q9H204<-->P51687: SUOX] NbExp=3 EBI-514199,EBI-3921347 [Q9H204<-->Q8WWU5-7: TCP11] NbExp=3 EBI-514199,EBI-17721485 [Q9H204<-->P07947: YES1] NbExp=2 EBI-514199,EBI-515331 [Q9H204<-->Q9D8C6: Med11] Xeno NbExp=2, [Q9H204<-->Q9CQI9: Med30] Xeno NbExp=2, [Q9H204<-->Q9D7W5: Med8] Xeno NbExp=2, [Q9H204<-->P03255] Xeno NbExp=2, |
| Repeats |
>MDP31640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (21.37/22.81) ELRNELQ.RKDALVQkH
135- 150 (24.48/19.69) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|
| Disease | breast cancer PMID:25723281 |
| MoRF Sequence | Start | Stop |
| NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab