<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31640
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 178 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.452 |
| Instability index | 61.27 |
| Isoelectric point | 5.39 |
| Molecular weight | 19519.94 |
| Publications | PubMed=11779215
PubMed=15489334
PubMed=15175163
PubMed=15467741
PubMed=15989967
PubMed=21269460
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. May be part of a complex
containing NF2/merlin that participates in cellular signaling to the
actin cytoskeleton downstream of tyrosine kinase signaling pathways.
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
mediator complex GO:0016592 IBA:GO_Central
membrane GO:0016020 IEA:UniProtKB-SubCell
nucleoplasm GO:0005654 IDA:HPA
|
| GO - Biological Function | actin binding GO:0003779 IEA:UniProtKB-KW
|
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP31640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (21.37/22.81) ELRNELQ.RKDALVQkH
135- 150 (24.48/19.69) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|
Associated diseases