<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31639
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAQNDPGSGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHNRPTPPINPGMLQGPSGMQQPMGGGVPPRPGLMPGMPPGGMSPVGPMPPGQQHMLQAQQMQQLRMMGKLPPK |
| Length | 190 |
| Position | Head |
| Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.668 |
| Instability index | 74.94 |
| Isoelectric point | 6.31 |
| Molecular weight | 21308.44 |
| Publications | PubMed=15632085
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | mediator complex GO:0016592 ISS:UniProtKB
|
| GO - Biological Function | transcription coregulator activity GO:0003712 ISS:UniProtKB
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 ISS:UniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31639
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.30| 19| 20| 123| 141| 1
---------------------------------------------------------------------------
123- 141 (42.13/17.75) PPINPGMLQG..PSGMQQPMG
145- 163 (30.38/10.96) PP.RPGLMPGmpPGGM.SPVG
166- 183 (27.79/ 9.46) PPGQQHMLQA..QQMQQLRM.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.19| 22| 31| 46| 67| 2
---------------------------------------------------------------------------
46- 67 (37.20/29.02) KTTNRFIDVARQMEAFFLQKRF
79- 100 (35.99/27.87) KDENQDLSIEIQRKEALLQKHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.97| 20| 24| 1| 20| 3
---------------------------------------------------------------------------
1- 20 (36.02/21.38) MAQNDPGSGNLMDEFEEAFQ
26- 45 (32.95/19.01) LTKQEPNSGTNKEEIELEVQ
---------------------------------------------------------------------------
|