<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31638
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MASNESGGGNLMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGSGMLQGPGGGMPPMGGTPPRPGMMPGMPPGAMQPGGPMQPSPHMLQAQQMQQLRMISRQMPPK |
Length | 189 |
Position | Head |
Organism | Drosophila melanogaster (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.652 |
Instability index | 73.86 |
Isoelectric point | 6.31 |
Molecular weight | 21079.14 |
Publications | PubMed=10731132
PubMed=12537572
PubMed=12537569
PubMed=12021283
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000269 PubMed:12021283
|
GO - Cellular Component | mediator complex GO:0016592 IDA:FlyBase
nucleus GO:0005634 IDA:FlyBase
|
GO - Biological Function | transcription coregulator activity GO:0003712 IPI:UniProtKB
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IPI:UniProtKB
|
Interaction
Repeat regions
Repeats |
>MDP31638
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.13| 18| 18| 122| 139| 1
---------------------------------------------------------------------------
122- 139 (39.60/16.35) TPPI..GSGM..LQG.PGGGMPP
143- 158 (24.15/ 7.30) TPP...RPGM..MPGmPPGAM..
167- 188 (23.38/ 6.86) SPHMlqAQQMqqLRM.ISRQMPP
---------------------------------------------------------------------------
|