<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31637
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MASSMCGMFPGQQPPGSLPPPGPGGPGQPGLLTGTPGNRGANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVEKEDASELKNELQRKEMLIQKHLAKIHHWQQVLEDINVQHKKPTELPQGPLAFLEQASANLPAPMKPN |
| Length | 179 |
| Position | Head |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.579 |
| Instability index | 47.00 |
| Isoelectric point | 5.23 |
| Molecular weight | 19697.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31637
No repeats found
|