<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31636
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQQPGPPQPPPGLLGQASLLQATPGVPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIKKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINMQHKKPADIPQGSLAYLEQASANIPAPMKQT |
| Length | 178 |
| Position | Head |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.499 |
| Instability index | 57.24 |
| Isoelectric point | 5.63 |
| Molecular weight | 19763.28 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. May be part of a complex
containing NF2/merlin that participates in cellular signaling to the
actin cytoskeleton downstream of tyrosine kinase signaling pathways (By
similarity).
ECO:0000250
|
| GO - Cellular Component | cytoplasm GO:0005737 IEA:UniProtKB-SubCell
membrane GO:0016020 IEA:UniProtKB-SubCell
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | actin binding GO:0003779 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31636
No repeats found
|