<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31634
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MASSSNVNGNLVDELEEAFQSCIHALTKEESATGVDKDEIKLEVDQTTLKFIDLARQMEAFFLQKRFLLSALKPDLLLKEENFDLKQEIARKDELIRKHYEKIESWKNLLSDQQNYNKPIQSLPPDMRGNLTGGVPGGPGMMPGGIGMPMQNSMQVQQMQAQQQQMQMLQAQQMQQQMQSMPIG |
| Length | 184 |
| Position | Head |
| Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.609 |
| Instability index | 51.50 |
| Isoelectric point | 4.99 |
| Molecular weight | 20872.73 |
| Publications | PubMed=17510324
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31634
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.82| 13| 16| 148| 160| 1
---------------------------------------------------------------------------
148- 160 (26.49/12.83) MPMQNSMQVQQ.MQ
166- 179 (21.33/ 9.07) MQMLQAQQMQQqMQ
---------------------------------------------------------------------------
|