<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31633

Description Mediator of RNA polymerase II transcription subunit 27
SequenceMADALNVGVNLEAFSQAIHCIQALRSSVTRVFDCLKDGMKNKESQEARERAFVSEFQDNLHCVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVHDKTPLYSQLLQAYKWSNKLQFHAGLASGLLNQQSLKRSANQMGVSAKRRPKVQPTTLALPPQYIDDVISRIDRMFPEMTIQLSRPNGSSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDSCRQ
Length311
PositionTail
OrganismXenopus tropicalis (Western clawed frog) (Silurana tropicalis)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia> Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Silurana.
Aromaticity0.08
Grand average of hydropathy-0.338
Instability index42.68
Isoelectric point9.18
Molecular weight35478.41
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
retinal cone cell development	GO:0046549	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31633
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.34|      34|      34|      58|      91|       1
---------------------------------------------------------------------------
   18-   52 (32.73/17.98)	..IHCIQALRSSVTRVFDCLkdG.mKNKESQEAR...ERAF
   58-   91 (57.73/36.55)	DNLHCVNRDLNELERLSNLV..G..KPSENHPLH...NSGL
   95-  127 (35.89/20.33)	DPVH....DKTPL..YSQLL..QayKWSNKLQFHaglASGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.29|      32|      33|     147|     178|       2
---------------------------------------------------------------------------
  147-  178 (55.54/37.94)	RPKVQPTTLALPPQYIDDVISRIDRMFPEMTI
  182-  213 (48.75/32.53)	RPNGSSAMLLVTLGKVLKVIVVMRSLFIDRTI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31633 with Med27 domain of Kingdom Metazoa
Unable to open file!