<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31630

Description Mediator of RNA polymerase II transcription subunit 27
SequenceMADVLSVGVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIANFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNESVYTEDGKLDIWSKSSYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
Length311
PositionTail
OrganismMus musculus (Mouse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus.
Aromaticity0.08
Grand average of hydropathy-0.297
Instability index41.52
Isoelectric point9.37
Molecular weight35297.21
Publications
PubMed=16141072
PubMed=19468303
PubMed=15489334

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
cytosol	GO:0005829	ISO:MGI
mediator complex	GO:0016592	IDA:MGI
nucleolus	GO:0005730	ISO:MGI
nucleoplasm	GO:0005654	ISO:MGI
nucleus	GO:0005634	ISS:UniProtKB
transcription regulator complex	GO:0005667	ISO:MGI
ubiquitin ligase complex	GO:0000151	ISO:MGI
GO - Biological Function
transcription coactivator activity	GO:0003713	ISS:UniProtKB
ubiquitin protein ligase activity	GO:0061630	IEA:Ensembl
GO - Biological Process
protein ubiquitination	GO:0016567	ISO:MGI
regulation of transcription by RNA polymerase II	GO:0006357	ISO:MGI
stem cell population maintenance	GO:0019827	IMMGI

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.06|      32|      32|     147|     178|       1
---------------------------------------------------------------------------
  147-  178 (55.24/41.65)	RPKAQPTTLVLPPQYVDDVISRIDRMFPEMSI
  182-  213 (48.82/35.99)	RPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.14|      16|     230|      56|      71|       4
---------------------------------------------------------------------------
   56-   71 (28.66/18.60)	FQDNLHSVNRDLNELE
  288-  303 (31.48/21.06)	LQDGLPPTWRDFRTLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31630 with Med27 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA