<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31630
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MADVLSVGVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIANFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNESVYTEDGKLDIWSKSSYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ |
| Length | 311 |
| Position | Tail |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.297 |
| Instability index | 41.52 |
| Isoelectric point | 9.37 |
| Molecular weight | 35297.21 |
| Publications | PubMed=16141072
PubMed=19468303
PubMed=15489334
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | cytosol GO:0005829 ISO:MGI
mediator complex GO:0016592 IDA:MGI
nucleolus GO:0005730 ISO:MGI
nucleoplasm GO:0005654 ISO:MGI
nucleus GO:0005634 ISS:UniProtKB
transcription regulator complex GO:0005667 ISO:MGI
ubiquitin ligase complex GO:0000151 ISO:MGI
|
| GO - Biological Function | transcription coactivator activity GO:0003713 ISS:UniProtKB
ubiquitin protein ligase activity GO:0061630 IEA:Ensembl
|
| GO - Biological Process | protein ubiquitination GO:0016567 ISO:MGI
regulation of transcription by RNA polymerase II GO:0006357 ISO:MGI
stem cell population maintenance GO:0019827 IMMGI
|
Interaction
Repeat regions
| Repeats |
>MDP31630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.06| 32| 32| 147| 178| 1
---------------------------------------------------------------------------
147- 178 (55.24/41.65) RPKAQPTTLVLPPQYVDDVISRIDRMFPEMSI
182- 213 (48.82/35.99) RPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.14| 16| 230| 56| 71| 4
---------------------------------------------------------------------------
56- 71 (28.66/18.60) FQDNLHSVNRDLNELE
288- 303 (31.48/21.06) LQDGLPPTWRDFRTLE
---------------------------------------------------------------------------
|