Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 27 |
Sequence | MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ |
Length | 275 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.322 |
Instability index | 40.43 |
Isoelectric point | 9.37 |
Molecular weight | 35431.35 |
Publications | PubMed=8889548 PubMed=15164053 PubMed=15489334 PubMed=9989412 PubMed=10882111 PubMed=15175163 PubMed=15989967 PubMed=21269460 PubMed=23186163 PubMed=24129315 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000269 PubMed:10882111 ECO:0000269 PubMed:9989412 |
GO - Cellular Component | cytosol GO:0005829 IDA:HPA mediator complex GO:0016592 IEA:InterPro nucleolus GO:0005730 IDA:HPA nucleoplasm GO:0005654 IDA:HPA nucleus GO:0005634 IDA:UniProtKB transcription regulator complex GO:0005667 IDA:MGI |
GO - Biological Function | transcription coactivator activity GO:0003713 IDA:UniProtKB |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IDA:MGI regulation of transcription initiation from RNA polymerase II promoter GO:0060260 TAS:Reactome transcription initiation from RNA polymerase II promoter GO:0006367 TAS:ProtInc |
Binary Interactions | [Q6P2C8<-->Q9NVC6: MED17] NbExp=3 EBI-394603,EBI-394562 [Q6P2C8<-->Q15528: MED22] NbExp=3 EBI-394603,EBI-394687 [Q6P2C8<-->O75586: MED6] NbExp=2 EBI-394603,EBI-394624 [Q6P2C8<-->Q9R0X0: Med20] Xeno NbExp=2, [Q6P2C8<-->Q9CQI9: Med30] Xeno NbExp=2, [Q6P2C8<-->Q9D7W5: Med8] Xeno NbExp=2, |
Repeats | >MDP31629 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.06| 32| 32| 147| 178| 1 --------------------------------------------------------------------------- 147- 178 (55.24/38.53) RPKAQPTTLVLPPQYVDDVISRIDRMFPEMSI 182- 213 (48.82/33.30) RPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTI --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab