<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31626

Description Mediator of RNA polymerase II transcription subunit 27
SequenceMADVMNVGVNLEAFSQAINAIQALRSSVTRVFDFLKDGMKNKETLESREKVFITEFQENLQSVNRDLNELERLSTLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGTSAKRRPKVQPSTLALPTQYVDDVISRIGRMFPDMSIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGFHENIYTEDRKLDIWSKSNYQAFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQTPCQRCGKYLQEGLPPTWRDFRTLEAFHDTCRQ
Length311
PositionTail
OrganismDanio rerio (Zebrafish) (Brachydanio rerio)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes> Danionidae> Danioninae> Danio.
Aromaticity0.09
Grand average of hydropathy-0.345
Instability index45.65
Isoelectric point9.45
Molecular weight35671.58
Publications
PubMed=16582438

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for the development of dopaminergic amacrine cells in the retina. May also negatively regulate the development of rod photoreceptor cells.
ECO:0000250	
ECO:0000269	PubMed:16582438
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
camera-type eye development	GO:0043010	IMZFIN
retinal cone cell development	GO:0046549	IMZFIN

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.82|      32|      32|     147|     178|       1
---------------------------------------------------------------------------
  147-  178 (55.59/47.96)	RPKVQPSTLALPTQYVDDVISRIGRMFPDMSI
  182-  213 (50.23/42.58)	RPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.90|      15|      25|     268|     283|       2
---------------------------------------------------------------------------
  268-  283 (26.43/22.28)	TWlRSYIKL..FQTPCQR
  295-  311 (26.47/17.05)	TW.RDFRTLeaFHDTCRQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31626 with Med27 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA