<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31622
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MNLEPINNALSHLRMLRSSVGQVFETLGNGVRAEHGEEGKEQKFLQELQELLNGVNSNLREFETCINDLTPPQAPFNLANTAYLSLETNLERQALYPHLVQSYKWHDKLHEYSTFASVLLQQNSLKRSYYTNTKRRRSLPSSHLATPQTVDNLIGSIHFPNMNLKIVRPFMTNAILHITIARVLRAAVILKGLLIEWVTVKGFDESLLDGVDEHWTVSRHQVFRKVQDHAHSAMLHFFSPTLPDLAIRSFITWFRSYLTLFADPCKKCGKHLHNTLPPTWRDLRTLEPYHEECKQ |
| Length | 295 |
| Position | Tail |
| Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.358 |
| Instability index | 47.87 |
| Isoelectric point | 8.62 |
| Molecular weight | 34075.60 |
| Publications | PubMed=17510324
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31622
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.22| 15| 26| 252| 267| 1
---------------------------------------------------------------------------
252- 267 (25.36/22.10) TW..FRSyLTLFADPCKK
279- 295 (25.86/16.31) TWrdLRT.LEPYHEECKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.48| 23| 23| 49| 71| 2
---------------------------------------------------------------------------
27- 47 (26.86/19.59) ..LGNGVRAEHGEEGKEQ..KFLQE
49- 71 (38.28/31.19) QELLNGVNSNLREFETCI..NDLTP
73- 97 (30.33/23.12) QAPFNLANTAYLSLETNLerQALYP
---------------------------------------------------------------------------
|