<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31621
| Description |
Mediator of RNA polymerase II transcription subunit 26 |
| Sequence | MTAAPASPQQMRDRLLQAIDSQSNIRNMVAVLEVISSLERYPITKEALEETRLGKLINDVRKKTKNEELAKRAKRLLRSWQKLIEPVHQNEVALRALAGAAGSANGGAHNCRPEMGVAGAPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGHPGPPHKVSKGSPDPLVPNASPLPTNGISGSPESLPSPLDGSGHLGPDGSRLEPSDNEKHSTKIPVNAVRPRPSSPGLGKPPVPCLQTKAAQLQQLDRADESPGPPYPRGSSRCSFSPRNSRHEGSFSRHRSSYIPKGQVSSPSPWPQPPDNTQVPSPLPLAQPPTPPVRRQELLPNAESPVHWPEQSEGHPRLTGPACRAGFSPDSSKADSDATSSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIRPLTQKEPVRADSPVPTEQLPRTELEQQEVKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMAEYLKQEESSRQGARQPHVLLPLPTPTDLPGLTREVTQDDLDRIQAQQWPGVNGCEDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD |
| Length | 588 |
| Position | Unknown |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.906 |
| Instability index | 66.53 |
| Isoelectric point | 9.29 |
| Molecular weight | 64678.73 |
| Publications | PubMed=16141072
PubMed=15489334
PubMed=21183079
PubMed=20111005
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional pre-initiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IDA:MGI
nucleoplasm GO:0005654 TAS:Reactome
|
| GO - Biological Function | transcription coregulator activity GO:0003712 ISS:UniProtKB
|
| GO - Biological Process | positive regulation of gene expression GO:0010628 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 ISS:UniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31621
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 175.06| 36| 37| 280| 315| 1
---------------------------------------------------------------------------
158- 181 (34.67/ 8.95) ......HPG..........PPHKVSKGSPDP.LVPNASPLP
203- 238 (42.59/12.54) GPdgsrLEPSDNEKHSTKIP...VNAVRPRP.SSPGLGK.P
275- 313 (57.00/19.07) P.rnsrHEGSFSRHRSSYIPKGQVSSPSPWP.QPPDNTQVP
314- 352 (40.80/11.73) SPlplaQPPTPPVRRQELLPNAE..SPVHWPeQSEGHPRLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.20| 18| 19| 438| 455| 2
---------------------------------------------------------------------------
438- 455 (30.98/20.65) PTEQLPRTELEQQEVKAS
459- 476 (30.22/19.95) PFEQTNWKELSRNEIIQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.03| 15| 22| 477| 493| 5
---------------------------------------------------------------------------
477- 493 (22.28/17.73) YLSRQSSllSSSGAQTP
502- 516 (27.74/15.74) YLKQEES..SRQGARQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.34| 15| 16| 95| 110| 8
---------------------------------------------------------------------------
95- 110 (21.99/17.52) RALAGAAGsANGGAHN
112- 126 (28.35/17.81) RPEMGVAG.APKSIHD
---------------------------------------------------------------------------
|