<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31616
| Description |
Mediator of RNA polymerase II transcription subunit 26 |
| Sequence | MTAAPPSPQQIRDRLLQAIDPQSNIRNMVAVQEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPVHQNEAALRGLAGAPGSANGGAHNCRPEAGAAGPPKSVHDLKYRNDMPRLCGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDSLVPNSSPLPTNGISGSPESFPSPLDSSGHVGPEGNRLEHGENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQTKAVVLQQLDKVDETPGPPHPKGPPRCSLGSRNSRHEGSFARQRSPYTYKGSLPSPSPRPQSLDATQVPSPLPLAQPSTPPVRRLELLPSAESPVRWLEQPEGHQRLAGLGCKAGLPPAEPLLPRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHTEQPRTELDKPEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRRGARKPHVLVPHGPPTDFPGLSREVTRDDLDKIQAHQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD |
| Length | 599 |
| Position | Unknown |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.890 |
| Instability index | 60.12 |
| Isoelectric point | 9.46 |
| Molecular weight | 65513.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional pre-initiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 ISS:UniProtKB
|
| GO - Biological Function | transcription coregulator activity GO:0003712 ISS:UniProtKB
|
| GO - Biological Process | positive regulation of gene expression GO:0010628 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 ISS:UniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31616
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 109.60| 24| 26| 298| 321| 1
---------------------------------------------------------------------------
222- 245 (34.64/ 9.54) PVNAVRPH.TSSPGLGKPPGPCLQT
263- 287 (30.31/ 7.50) PHPKGPPRcSLGSRNSRHEGSFARQ
298- 321 (44.65/14.24) PSPSPRPQ.SLDATQVPSPLPLAQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 313.13| 65| 109| 324| 390| 2
---------------------------------------------------------------------------
172- 202 (33.53/ 9.00) ..........................................SL.VPNS.SP....LPTNGISGSPES..FPSP.LDSSGHV
324- 390 (108.99/51.28) PPVRRL..ELLPS.....AESPVRWLEQPegHQRLAGLGCKAGL.PPAE.PL....LPRAGFSPDSSK..ADSDAASSGGSD
429- 502 (85.69/35.37) PMTRQI..KPLTQkepvrADSPVH.TEQP..RTELDKPEAKASLqSPFE.QTnwkeLSRNEIIQSYLS..RQSSLLSSSGAQ
504- 567 (84.91/34.99) PGAHHFmsEYLKQ.....EESTRRGARKP..H.VLVPHG......PPTDfPG....LSREVTRDDLDKiqAHQWPGVNGCQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.05| 20| 267| 128| 156| 3
---------------------------------------------------------------------------
123- 142 (35.56/17.36) SVHDLKYRNDMPRLCGQRLD
152- 171 (35.49/14.11) DQRDLGHPGPPPKVSKASHD
---------------------------------------------------------------------------
|