<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31614

Description Mediator of RNA polymerase II transcription subunit 25
SequenceMVDKLIVAVEGTAVLGPYWKIIVSDYLDKIIRCFFGVDSTSQKSSAADVEVSMVMFNTHGPYSACLVQRSGWTKDMDTFLQWLSAIPFSGGGFNDAAVAEGLAEALVMFSVPNGNQTQQKMEGKKHCILISGSNPYPLPTPVYRPQMQKLEQNENIEAQTDSRLADAETVAKTFPQCSISLSVICPKKLPKLRAIYDAGKHNPRAADPPIDTAKNPNFLVLISENFIEARAAFSRSGLTNLASNHSPVKMDVSSVLPVSGTQSISNSAANVSVISRPPISAGNIPPATVKIEPNTVTPMTGPGFSHIPSVRPALQPVPSLQASSPLSVSQEMVSHTENVQEMKPIVSGMTQSLRPVAAAAANVKILNGVAQAHQVLGGGTSIGLQSMGGTPMLSSMISSGMASSVPASQAVLSSGQSGVTTMTGAVPLAGSAQNTQNSAPSSFTSTAPSMSGQTVPAMSQGNIPGTQMMPSGTGMNQNMLTGLGATGLPSGTGTMMPTPGMSQQGQPGMQPVGVNSTSANMPLSQQQTSGALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPSQQQQQQQQQQLQAQHPQLQQQQQQQQQHLTQLQQQPLQQLQQQQQQQPLMQLQQQQQIPLQQSQVPQMQQQQIHQMQQQQQIPQMQQQQQIPQMQQQQQQQPMVGTGMNQTYMQGPARSQLMSQSQGSSQGLPITPGGGFMN
Length805
PositionUnknown
OrganismSolanum lycopersicum (Tomato) (Lycopersicon esculentum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum> Solanum subgen. Lycopersicon.
Aromaticity0.04
Grand average of hydropathy-0.330
Instability index60.65
Isoelectric point9.01
Molecular weight86437.49
Publications
PubMed=22660326
PubMed=30610166

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors (By similarity). Plays a positive role in wound-induced activation of jasmonate-responsive genes whose promoters are targeted by MYC2 (PubMed:30610166). 
ECO:0000250	UniProtKB:Q7XYY2
ECO:0000269	PubMed:30610166
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central
GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     150.72|      22|      23|     714|     735|       1
---------------------------------------------------------------------------
  676-  699 (32.74/ 8.98)	AQHPQLQQQQQQQqqHLTQLQQQP
  700-  722 (38.14/11.82)	LQQLQ.QQQQQQPlmQLQQQQQIP
  723-  746 (42.31/14.01)	LQQSQVPQMQQQQihQMQQQQQIP
  749-  765 (37.53/11.49)	QQQQQIPQMQQ......QQQQQ.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     307.50|      49|      49|     422|     470|       2
---------------------------------------------------------------------------
  194-  243 (34.99/ 9.10)	...A....IYDAGK.HNPRAADPPIDTAKN.PNflvlISENFI.....EaraAFSRSGL..T.NLAS
  244-  286 (45.25/13.80)	NHSP....VKMDVSS.....VLPVSGTQSI..S....NSAANVsvisrP...PISAGNIP......P
  299-  344 (51.75/16.78)	MTGPgfshIP...SVRPALQPVP.SLQASS.PL....SVSQEM.....V...SHTE.NV..Q.EMKP
  422-  470 (88.82/33.74)	MTGA....VPLAGSAQNTQNSAPSSFTSTA.PS....MSGQTV.....P...AMSQGNIPGT.QMMP
  471-  511 (42.63/12.60)	...........SGTGMN.QN.MLTGLGATGlPS....GTG.TM..mptP...GMSQQGQPG...MQP
  517-  555 (44.07/13.26)	TSAN....MPL..SQQQ.........TSGAlPS....AQSKYV.....K....VWEGNLSGQrQGQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.04|      15|      16|     381|     395|       5
---------------------------------------------------------------------------
  381-  395 (27.45/14.35)	SIGLQS..MGGTPMLSS
  398-  414 (20.59/ 8.75)	SSGMASsvPASQAVLSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.61|      27|     709|      59|      93|       9
---------------------------------------------------------------------------
   59-   93 (44.14/33.63)	HGPYSACLVQRSGWTKdmdtflQWLSAIPfsGGGF
  777-  803 (51.46/22.53)	QGPARSQLMSQSQGSS......QGLPITP..GGGF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31614 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QIPQMQQQQQIPQMQQQQQQQPMVGTGMNQTYMQGPARSQLMSQSQGSSQGLPITPGGGFMN
2) SVPASQAVLSSGQSGVTTMTGAVPLAGSAQNTQNSAPSSFTSTAPSMSGQTVPAMSQGNIPGTQMMPSGTGMNQNMLTGLGATGLPSGTGTMMPTPGMSQQGQPGMQPVGVNSTSANMPLSQQQTSGA
744
404
805
531










Molecular Recognition Features






MoRF SequenceStartStop




NANANA