Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT |
Length | 121 |
Position | Head |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Saccharomyces. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.335 |
Instability index | 34.74 |
Isoelectric point | 4.60 |
Molecular weight | 13862.63 |
Publications | PubMed=8324825 PubMed=8465606 PubMed=7813418 PubMed=24374639 PubMed=8187178 PubMed=9660972 PubMed=9671455 PubMed=14562095 PubMed=14562106 PubMed=14623974 PubMed=15175151 PubMed=15477388 PubMed=16002404 PubMed=16076843 PubMed=16263706 PubMed=17192271 PubMed=22814378 PubMed=12191485 PubMed=16885025 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors. The Mediator complex unfolds to an extended
conformation and partially surrounds RNA polymerase II, specifically
interacting with the unphosphorylated form of the C-terminal domain
(CTD) of RNA polymerase II. The Mediator complex dissociates from the
RNA polymerase II holoenzyme and stays at the promoter when
transcriptional elongation begins.
ECO:0000269 PubMed:16076843 ECO:0000269 PubMed:16263706 ECO:0000269 PubMed:16885025 |
GO - Cellular Component | core mediator complex GO:0070847 IDA:SGD mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IDA:SGD |
Binary Interactions | [P32570<-->Q99278: MED11] NbExp=17 EBI-18039,EBI-27213 [P32570<-->P32569: SRB4] NbExp=11 EBI-18039,EBI-18025 |
Repeats | >MDP31590 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LYEKLEQTRTILSVKLAELINMTTIADRN 2) SFAQE | 6 40 | 34 44 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab