Description | Isoform Surf5A of Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA |
Length | 140 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.565 |
Instability index | 61.89 |
Isoelectric point | 4.56 |
Molecular weight | 22220.49 |
Publications | PubMed=8586415 PubMed=11891058 PubMed=14702039 PubMed=15164053 PubMed=15489334 PubMed=12584197 PubMed=15989967 PubMed=21269460 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | cytoplasm GO:0005737 TAS:ProtInc mediator complex GO:0016592 IDA:MGI |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions | [Q15528<-->Q9P086: MED11] NbExp=3 EBI-394687,EBI-394704 [Q15528<-->Q9NVC6: MED17] NbExp=4 EBI-394687,EBI-394562 [Q15528<-->Q9BUE0: MED18] NbExp=3 EBI-394687,EBI-394640 [Q15528<-->Q6P2C8: MED27] NbExp=3 EBI-394687,EBI-394603 [Q15528<-->Q9H204: MED28] NbExp=2 EBI-394687,EBI-514199 [Q15528<-->Q9NX70: MED29] NbExp=4 EBI-394687,EBI-394656 [Q15528<-->Q9D8C6: Med11] Xeno NbExp=2, [Q15528<-->Q9CQI9: Med30] Xeno NbExp=6, [Q15528<-->Q9D7W5: Med8] Xeno NbExp=2, [Q15528-2<-->O14964: HGS] NbExp=3 EBI-12954271,EBI-740220 [Q15528-2<-->P42858: HTT] NbExp=12 EBI-12954271,EBI-466029 [Q15528-2<-->Q96HA8: NTAQ1] NbExp=3 EBI-12954271,EBI-741158 [Q15528-2<-->P60891: PRPS1] NbExp=3 EBI-12954271,EBI-749195 [Q15528-2<-->O14530: TXNDC9] NbExp=3 EBI-12954271,EBI-707554 [Q15528-2<-->O76024: WFS1] NbExp=3 EBI-12954271,EBI-720609 |
Repeats | >MDP31583 No repeats found No repeats found |
Disease | glomerular diseases PMID:33208756 |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab