<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31582
| Description |
Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
| Length | 143 |
| Position | Head |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.580 |
| Instability index | 46.88 |
| Isoelectric point | 5.48 |
| Molecular weight | 16593.76 |
| Publications | PubMed=10731132
PubMed=12537572
PubMed=10731137
PubMed=12537569
PubMed=12021283
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000269 PubMed:12021283
|
| GO - Cellular Component | chromatin GO:0000785 IDA:FlyBase
mediator complex GO:0016592 IDA:FlyBase
nucleolus GO:0005730 IDA:FlyBase
nucleus GO:0005634 IDA:FlyBase
P:regulation of transcription by RNA polymerase II GO:0006357 IFlyBase
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | mitotic cell cycle GO:0000278 HMFlyBase
regulation of transcription by RNA polymerase II GO:0006357 IC:FlyBase
regulation of transcription from RNA polymerase II promoter involved in spermatogenesis GO:1902064 IMFlyBase
|
Interaction
Repeat regions
| Repeats |
>MDP31582
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.48| 18| 38| 25| 42| 1
---------------------------------------------------------------------------
25- 42 (29.26/21.80) LKDDVR..SMLENFEEILKL
62- 81 (24.11/16.80) LEMQVRaaNMVRAGESLMKL
85- 97 (15.11/ 8.04) LKQYL....ILNDFHSV...
---------------------------------------------------------------------------
|