<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31581
| Description |
Putative mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MNTGGNNSLPPQTRGEVLFRDQQFFQKQIDSKIMQLLENYHNIIKISKVNDPLKNASEIYEMETRTSNMLNAGEGLLKIIEELKQNLILNDFSTMAEEVRIQNLVFHKENERTNKSIKLISEELSRSLKELEDEYYNSSYKLPPPSSSK |
| Length | 149 |
| Position | Head |
| Organism | Dictyostelium discoideum (Slime mold) |
| Kingdom | Amoebozoa |
| Lineage | Eukaryota> Amoebozoa> Evosea> Eumycetozoa> Dictyostelia> Dictyosteliales>
Dictyosteliaceae> Dictyostelium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.749 |
| Instability index | 46.70 |
| Isoelectric point | 5.51 |
| Molecular weight | 17282.37 |
| Publications | PubMed=15875012
PubMed=18515835
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | core mediator complex GO:0070847 ISS:dictyBase
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 ISS:dictyBase
|
Interaction
Repeat regions
| Repeats |
>MDP31581
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.91| 13| 14| 31| 43| 1
---------------------------------------------------------------------------
31- 43 (23.21/14.46) SKIMQLLENYHNI
47- 59 (21.70/13.14) SKVNDPLKNASEI
---------------------------------------------------------------------------
|