Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSNQVLLDKLDRTTESLSQALAQLVKLSSIDRASADSDGDNDGTTDSITSVATNGVMMVHAHTTQLIRGVQDLLVITRAIRETWVLGQIPKKNGDEDAIDYEKCERLLEKAMDDFFGPVAL |
Length | 121 |
Position | Head |
Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.231 |
Instability index | 11.59 |
Isoelectric point | 4.55 |
Molecular weight | 13248.78 |
Publications | PubMed=15001715 PubMed=23749448 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP31573 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AIDYEKCERLLEKAM 2) FGPVAL 3) LAQLVKLSSIDRASAD | 98 116 21 | 112 121 36 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab