| Description | Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MSDKLTQIQDELDALLNMMQRQIAHIVLQAPPSVPPGQHRVDTMPEIKGKAASENPQSNPPQPAEPPVPEKISPEQFNQDLKEFSRDIVVKQQQVELLIASLPGLNVSEEQQVARMKELEKELEGLEDERAQAVREKEVLLKKVEDKIMSVGRSR |
| Length | 155 |
| Position | Middle |
| Organism | Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Phaeosphaeriaceae> Parastagonospora. |
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.699 |
| Instability index | 62.33 |
| Isoelectric point | 4.98 |
| Molecular weight | 17475.77 |
| Publications | PubMed=18024570 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP31565
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.71| 18| 22| 104| 124| 1
---------------------------------------------------------------------------
89- 106 (27.32/13.64) VVKQQQV...ELLIASLPGLN
107- 127 (24.39/18.92) VSEEQQVarmKELEKELEGLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.52| 15| 22| 31| 46| 2
---------------------------------------------------------------------------
31- 46 (26.93/16.83) PPSVPPgQHRVDTMPE
56- 70 (31.59/15.49) PQSNPP.QPAEPPVPE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KGKAASEN 2) VPEKISPEQFNQDLKEFSR | 48 68 | 55 86 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab