<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31564
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MSDRLSQLQEAVDQLMEQFIATYFYIDRHHDLKTFSPKDTIAPSKADQPPEVDTLPPDVFQAGQLELARDLITREQQIEYLISSLPGLDNSEQDQLQSIKELEEELNVAEKQRQEAVKEKDEVLVKLDQTLRSIRRY |
| Length | 137 |
| Position | Middle |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.732 |
| Instability index | 64.01 |
| Isoelectric point | 4.53 |
| Molecular weight | 15929.64 |
| Publications | PubMed=12712197
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription coregulator activity GO:0003712 IBA:GO_Central
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31564
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.37| 27| 33| 50| 77| 1
---------------------------------------------------------------------------
50- 77 (42.15/26.61) PEVDTLPPDVFQAGQlELARDLITREQQ
86- 112 (44.22/24.03) PGLDNSEQDQLQSIK.ELEEELNVAEKQ
---------------------------------------------------------------------------
|