<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31561
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MTDRLTQLQICLDQMMEQFCGAVNYVDKNHGFEPSNDSEEQMSDPQAHIVEEKEFEKNIDELTTDIILKTRQIMALIDSLPGVDVSAQEQLHRIDSLQKQLIKMEKEKIDAIKRKDALQEKVRTLTQDFTIGINESKTEARLV |
Length | 143 |
Position | Middle |
Organism | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.605 |
Instability index | 51.41 |
Isoelectric point | 4.75 |
Molecular weight | 16491.57 |
Publications | PubMed=15229592
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31561
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.48| 20| 20| 18| 37| 2
---------------------------------------------------------------------------
18- 37 (36.69/25.59) QFCGAVNYVDKNHGFEPSND
41- 60 (33.79/23.13) QMSDPQAHIVEEKEFEKNID
---------------------------------------------------------------------------
|