<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31559
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADILTQLQTCLDQLATQFYATIGYLTTYHDNSPAIPPDNPTSAPALAKIQKNSTNPPIPAGAAAILNASQGSPSGAATGAVTPGPPAPNASAGSGAGEAGAARQEEGLPPRPDSPRTFTARQRELARDLVIKEQQIEYLISVLPGIGSSEAEQERRIRKLEEELRAVEEEREKRVRELRVLRRRVEEVLGAVEGGIYGGSSY |
Length | 203 |
Position | Middle |
Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.483 |
Instability index | 65.12 |
Isoelectric point | 5.24 |
Molecular weight | 21625.92 |
Publications | PubMed=16372000
PubMed=19146970
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31559
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.89| 15| 15| 155| 169| 2
---------------------------------------------------------------------------
155- 169 (24.30/17.97) ERRIRKLEEELRAVE
173- 187 (24.58/18.25) EKRVRELRVLRRRVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.26| 20| 21| 69| 89| 3
---------------------------------------------------------------------------
69- 89 (36.21/15.50) ASQGSPSGAAtGAV..TPG.PPAP
91- 113 (30.04/ 9.52) ASAGSGAGEA.GAArqEEGlPPRP
---------------------------------------------------------------------------
|