<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31554
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MTDRLTQLQRCLDQVMEQFCATLNFIDKRHDFEPFNDKEPKMTDKHASVATPEEFSNGIDELSTDIIVKIRQITTLIDSLPGVGVSAEEQLHKIDSLQKKLVDIEDEKIHAIKKKDDLLKQVDDLITVFVGGIADSRRGTSLAPENVQEDNDIKQEAEVPTSSEAIEQKIANEKIESKIEGEYNDNINEDSDSKSADSELFMDKDDADNISESISPGKI |
| Length | 219 |
| Position | Middle |
| Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Nakaseomyces>
Nakaseomyces/Candida clade.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.676 |
| Instability index | 52.25 |
| Isoelectric point | 4.42 |
| Molecular weight | 24564.98 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31554
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.67| 14| 15| 77| 90| 1
---------------------------------------------------------------------------
77- 90 (23.81/14.64) IDSLPGVGVSAEEQ
94- 107 (22.85/13.81) IDSLQKKLVDIEDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.21| 22| 38| 133| 154| 2
---------------------------------------------------------------------------
133- 154 (37.29/20.93) IADSRRGTSLAPE...NVQEDNDIK
170- 194 (30.92/16.33) IANEKIESKIEGEyndNINEDSDSK
---------------------------------------------------------------------------
|