Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MTDRLTQLQRCLDQVMEQFCATLNFIDKRHDFEPFNDKEPKMTDKHASVATPEEFSNGIDELSTDIIVKIRQITTLIDSLPGVGVSAEEQLHKIDSLQKKLVDIEDEKIHAIKKKDDLLKQVDDLITVFVGGIADSRRGTSLAPENVQEDNDIKQEAEVPTSSEAIEQKIANEKIESKIEGEYNDNINEDSDSKSADSELFMDKDDADNISESISPGKI |
Length | 219 |
Position | Middle |
Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.676 |
Instability index | 52.25 |
Isoelectric point | 4.42 |
Molecular weight | 24564.98 |
Publications | PubMed=15229592 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP31554 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.67| 14| 15| 77| 90| 1 --------------------------------------------------------------------------- 77- 90 (23.81/14.64) IDSLPGVGVSAEEQ 94- 107 (22.85/13.81) IDSLQKKLVDIEDE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.21| 22| 38| 133| 154| 2 --------------------------------------------------------------------------- 133- 154 (37.29/20.93) IADSRRGTSLAPE...NVQEDNDIK 170- 194 (30.92/16.33) IANEKIESKIEGEyndNINEDSDSK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSKSADSELFMDKDDADNISESISPGKI 2) IANEKIESKIEGEYNDNINED | 192 170 | 219 190 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab