<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31553
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADRLTQLQICLDQLIQQFNSTINYVNTSAEPSLLDDDDVNSYSNMAANAPLPQSQQQRQQQKKQQEPQQEIEQPQQQSNPESKSISPPKEKVSFDNVINELCTDLILKSRQIKMLIDSLPGIGVTPNEQMNLINELSDKLQAIEEERIQKIKEKDNLLNLLESMIKEVVNGITETRI |
| Length | 178 |
| Position | Middle |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.719 |
| Instability index | 67.05 |
| Isoelectric point | 4.54 |
| Molecular weight | 20288.65 |
| Publications | PubMed=15123810
PubMed=17419877
PubMed=24025428
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.65| 17| 17| 52| 68| 1
---------------------------------------------------------------------------
52- 68 (30.53/14.35) LPQSQQQRQQQKKQQEP
72- 88 (30.12/14.07) IEQPQQQSNPESKSISP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.40| 13| 15| 128| 141| 2
---------------------------------------------------------------------------
128- 141 (17.41/14.59) NEQMNLINElSDKL
146- 158 (20.99/12.31) EERIQKIKE.KDNL
---------------------------------------------------------------------------
|