<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31549
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADILTQLQTCLDQLATQFYATIGYLVTYHDNSPAIPPQNDPTAAPALAKITKNSTAPPAPAGAPAGSQASPQQQSAQIPGQQQQGGGDAGQTPGAGGGTGGAGADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIKELEKELRSAEEDREQRVRELRKLRKKLENVLGAVEVGIYGDRGAVASRR |
| Length | 208 |
| Position | Middle |
| Organism | Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.648 |
| Instability index | 65.82 |
| Isoelectric point | 5.35 |
| Molecular weight | 22130.37 |
| Publications | PubMed=16372010
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31549
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.00| 41| 49| 42| 85| 1
---------------------------------------------------------------------------
42- 84 (63.80/33.72) PTAAPALAKITKNSTAPPAPaGAPAgSQASPQQQSAQ..IPGQQQ
94- 136 (69.20/26.88) PGAGGGTGGAGADPNLPPAP.DSPR.TFASRQRELARdlVIKEQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.85| 15| 15| 149| 163| 2
---------------------------------------------------------------------------
149- 163 (24.62/18.16) SSEAEQERRIKELEK
167- 181 (25.23/18.77) SAEEDREQRVRELRK
---------------------------------------------------------------------------
|