<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31548
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDNIPATPPPTSTTPSAAPLLAKIPKNASTPPVPASAPQAAQSQSQASPPPPDTANPQTGGQHADQQQQSPDGEGLPAPDSPATFAARQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIRELEGELRIVEGVREERRRELGVLRRRLEGVLGVVERGIYSRD |
| Length | 196 |
| Position | Middle |
| Organism | Aspergillus niger (strain CBS 513.88 / FGSC A1513) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.582 |
| Instability index | 81.35 |
| Isoelectric point | 4.96 |
| Molecular weight | 21369.64 |
| Publications | PubMed=17259976
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31548
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.92| 17| 17| 44| 60| 1
---------------------------------------------------------------------------
44- 60 (31.40/16.52) PSAAPLLAKIPKNASTP
63- 79 (30.52/15.87) PASAPQAAQSQSQASPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.94| 24| 24| 142| 165| 2
---------------------------------------------------------------------------
109- 129 (28.23/14.52) ..DSPATFAARQ.....RELARDLVIKE
141- 164 (40.48/23.46) GIDSSEAEQERRI....RELEGELRIVE
165- 189 (28.23/14.52) GV...REERRRELgvlrRRLEGVLGVVE
---------------------------------------------------------------------------
|