Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MDIISQLQEQVNTIAAITFNAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE |
Length | 139 |
Position | Middle |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.374 |
Instability index | 55.31 |
Isoelectric point | 4.46 |
Molecular weight | 15040.82 |
Publications | PubMed=19286969 PubMed=10617198 PubMed=27862469 PubMed=14593172 PubMed=17560376 PubMed=22021418 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Required for embryo development
and defense against necrotrophic fungal pathogens.
|
GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB polar nucleus GO:0043078 IMP:UniProtKB |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | C:polar nucleus GO:0043078 IMUniProtKB defense response to fungus GO:0050832 IMUniProtKB regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central regulation of transcription, DNA-templated GO:0006355 TAS:TAIR |
Binary Interactions |
Repeats | >MDP31544 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.19| 19| 25| 81| 105| 2 --------------------------------------------------------------------------- 81- 105 (25.86/24.18) LSEGGEGAQ..LKRIAELqvendlVGQ 107- 127 (27.33/13.56) LQKQLEAAEkeLKQVQEL......FGQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQPKQLSAGLVKAAKQFDALVAALPL 2) GAQLKRIAELQVENDLV | 56 87 | 81 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab