<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31544
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIISQLQEQVNTIAAITFNAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE |
| Length | 139 |
| Position | Middle |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.374 |
| Instability index | 55.31 |
| Isoelectric point | 4.46 |
| Molecular weight | 15040.82 |
| Publications | PubMed=19286969
PubMed=10617198
PubMed=27862469
PubMed=14593172
PubMed=17560376
PubMed=22021418
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Required for embryo development
and defense against necrotrophic fungal pathogens.
|
| GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB
polar nucleus GO:0043078 IMP:UniProtKB
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | C:polar nucleus GO:0043078 IMUniProtKB
defense response to fungus GO:0050832 IMUniProtKB
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
regulation of transcription, DNA-templated GO:0006355 TAS:TAIR
|
Interaction
Repeat regions
| Repeats |
>MDP31544
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.19| 19| 25| 81| 105| 2
---------------------------------------------------------------------------
81- 105 (25.86/24.18) LSEGGEGAQ..LKRIAELqvendlVGQ
107- 127 (27.33/13.56) LQKQLEAAEkeLKQVQEL......FGQ
---------------------------------------------------------------------------
|