<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31543
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADRLTQLQDTVNQQAEHFCNSIGILQQCSVPSKFAGFERTGSQTPQQQVHQQQQLPQQQQQQQQPQQQEDFPQLFSTLISRCAKDIDTLIESLPSEESSIELQVQSLQRLEAENKESAEKLEEIVRKGELLLEKIQAALSDIAQSQLDMQYSS |
Length | 154 |
Position | Middle |
Organism | Anopheles gambiae (African malaria mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.761 |
Instability index | 75.79 |
Isoelectric point | 4.49 |
Molecular weight | 17514.22 |
Publications | PubMed=12364791
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31543
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.21| 14| 14| 44| 57| 1
---------------------------------------------------------------------------
44- 57 (27.33/ 8.84) QTPQQQVHQQQQLP
60- 73 (27.88/ 9.14) QQQQQQPQQQEDFP
---------------------------------------------------------------------------
|