<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31540
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MVTILQYSADVTATTISTYRSELSAQLAQNLGKWSFELKMYKPNPASIGRSEHHNGNIPQGQQEAAAADQEIGGVAALYTLTQAHSKGDMVYVTQGSAVQGQPGVVVSDSFDMVLQNKMKSIWILRQTLRGDGAEYELMGDAYGRVKVRLANVFLQGTFRGLLFQYEYEGDTLDDRQQQHLMEFIQSSGFPSSNLIIGGNGSGLVQTGTQFVEALAQK |
| Length | 218 |
| Position | Head |
| Organism | Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Dipodascaceae> Yarrowia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.274 |
| Instability index | 34.93 |
| Isoelectric point | 5.34 |
| Molecular weight | 23834.48 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31540
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.12| 28| 29| 128| 156| 1
---------------------------------------------------------------------------
128- 156 (45.22/31.53) TLRGDGAEYELMGDAY.GRVKVRLANvFLQ
158- 186 (47.90/29.17) TFRGLLFQYEYEGDTLdDRQQQHLME.FIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.07| 21| 29| 53| 75| 2
---------------------------------------------------------------------------
53- 75 (33.15/22.50) HHNGNIPQGQQEAAAADQEigGV
85- 105 (37.92/19.88) HSKGDMVYVTQGSAVQGQP..GV
---------------------------------------------------------------------------
|