<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31538
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVSQMPVAEGKSVQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPTVFGNRHDAVYGPADTMVQYMELFNKVRKQQQVPVAGIR |
Length | 212 |
Position | Head |
Organism | Rattus norvegicus (Rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Rattus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.012 |
Instability index | 28.79 |
Isoelectric point | 6.42 |
Molecular weight | 23179.51 |
Publications | PubMed=15489334
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 ISO:RGD
ubiquitin ligase complex GO:0000151 IDA:RGD
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | protein ubiquitination GO:0016567 IDA:RGD
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
skeletal muscle cell differentiation GO:0035914 ISO:RGD
|
Interaction
Repeat regions
Repeats |
>MDP31538
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.69| 23| 71| 115| 138| 1
---------------------------------------------------------------------------
115- 138 (38.73/24.17) TRYQYCDFLVKVGTVTMGPSArGI
189- 211 (38.97/20.37) TMVQYMELFNKVRKQQQVPVA.GI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.26| 25| 61| 80| 104| 2
---------------------------------------------------------------------------
80- 104 (45.91/24.32) ENGPCLIADTNFDVLMVKLKGFFQS
143- 167 (47.35/25.24) EYGPCVVASDCWSLLLEFLQSFLGS
---------------------------------------------------------------------------
|