<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31537
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MVSAVLLIQKATPETITQFHDQLSNELPTLRGKWNFNFKIFRNNPYSIPQELAETATVAPESKWLYTLSPSYLSDSSISLINGKSVGVFTNLIKEEAGEHGHSVELSIPNSHLHKGATTDLNDPFDFFVAQKLQSLWTQRQLIRGDGGRIYELENGNLTIRTSNVFLHGNFRGLLVQIEINQNLCNVDDVSSFASTFETIRNKYGIPAGDLSCEVLDPKRLDTYADLIYQYSKILNF |
Length | 237 |
Position | Head |
Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.259 |
Instability index | 24.67 |
Isoelectric point | 5.51 |
Molecular weight | 26702.76 |
Publications | PubMed=17334359
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31537
No repeats found
No repeats found
|