| Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGVTCVSQMPVAEGKSLQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHAPGAPTVFGNRHDAVYGPADTMIQYMELFNKIRKQQQVPVAGIR |
| Length | 145 |
| Position | Head |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.025 |
| Instability index | 31.59 |
| Isoelectric point | 6.42 |
| Molecular weight | 23191.56 |
| Publications | PubMed=16141072 PubMed=15489334 PubMed=12037571 PubMed=21183079 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IDA:MGI nucleoplasm GO:0005654 TAS:Reactome ubiquitin ligase complex GO:0000151 ISO:MGI |
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
| GO - Biological Process | protein ubiquitination GO:0016567 ISO:MGI regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central skeletal muscle cell differentiation GO:0035914 IMMGI |
| Binary Interactions | [Q9R0X0<-->Q9CQI9: Med30] NbExp=2 EBI-398698,EBI-309220 [Q9R0X0<-->Q9D7W5: Med8] NbExp=2 EBI-398698,EBI-7990252 [Q9R0X0<-->Q9BUE0: MED18] Xeno NbExp=6, [Q9R0X0<-->Q6P2C8: MED27] Xeno NbExp=2, [Q9R0X0<-->Q9NX70: MED29] Xeno NbExp=2, [Q9R0X0<-->O75586: MED6] Xeno NbExp=2, |
| Repeats |
>MDP31536
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.09| 26| 37| 121| 146| 1
---------------------------------------------------------------------------
121- 146 (46.41/21.97) DFLVK.VGTVTMG.PSARGISVEVEYGP
159- 186 (40.68/18.69) EFLQSfLGSHAPGaPTVFGNRHDAVYGP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab