| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MTYYGVLFVEKCTPSTITQLQDVLSTDLISMGDKWSFELKTFRTSAKNTDPNDTKVMHTVQLSHKNNETVTIKNQSAIITPTYVTKALYDNGCVFGTPEPFDYMLSNKLSNIWTQRQSIKGEFGVSYQTADLSIRVNNAFSYSGFQGLILELESKSSDNLEAFEKNVERVRTMLSGMGLSDVRVSSDKSQGSKQEDSSLFDLAAHYLKVLG |
| Length | 211 |
| Position | Head |
| Organism | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kluyveromyces. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.361 |
| Instability index | 35.34 |
| Isoelectric point | 5.64 |
| Molecular weight | 23604.31 |
| Publications | PubMed=15229592 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP31535 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) SKQEDSSLFDLAAHYLKVLG 2) WSFELKT | 192 35 | 211 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab