Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR |
Length | 123 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.09 |
Grand average of hydropathy | 0.011 |
Instability index | 29.29 |
Isoelectric point | 6.42 |
Molecular weight | 23221.55 |
Publications | PubMed=9933582 PubMed=14702039 PubMed=14574404 PubMed=15489334 PubMed=17974005 PubMed=12584197 PubMed=15175163 PubMed=15989967 PubMed=21269460 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central nucleoplasm GO:0005654 TAS:Reactome ubiquitin ligase complex GO:0000151 IEA:Ensembl |
GO - Biological Function | DNA-directed 5'-3' RNA polymerase activity GO:0003899 NAS:UniProtKB transcription coactivator activity GO:0003713 IBA:GO_Central ubiquitin protein ligase activity GO:0061630 IEA:Ensembl |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central regulation of transcription initiation from RNA polymerase II promoter GO:0060260 TAS:Reactome transcription by RNA polymerase II GO:0006366 TAS:ProtInc transcription, DNA-templated GO:0006351 NAS:UniProtKB |
Binary Interactions | [Q9H944<-->Q49AR9: ANKS1A] NbExp=3 EBI-394644,EBI-11954519 [Q9H944<-->Q6BCY4-2: CYB5R2] NbExp=3 EBI-394644,EBI-12102608 [Q9H944<-->Q96DN0: ERP27] NbExp=3 EBI-394644,EBI-953772 [Q9H944<-->Q06547: GABPB1] NbExp=3 EBI-394644,EBI-618165 [Q9H944<-->Q6IPE9: MARK4] NbExp=3 EBI-394644,EBI-10250211 [Q9H944<-->Q9BUE0: MED18] NbExp=21 EBI-394644,EBI-394640 [Q9H944<-->Q9NX70: MED29] NbExp=6 EBI-394644,EBI-394656 [Q9H944<-->Q8WWB5: PIH1D2] NbExp=3 EBI-394644,EBI-10232538 [Q9H944<-->Q9UIG4: PSORS1C2] NbExp=3 EBI-394644,EBI-11974061 [Q9H944<-->Q6ZRS2-3: SRCAP] NbExp=3 EBI-394644,EBI-12029182 [Q9H944<-->Q86WT6-2: TRIM69] NbExp=3 EBI-394644,EBI-11525489 [Q9H944<-->P25490: YY1] NbExp=3 EBI-394644,EBI-765538 |
Repeats | >MDP31534 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 88.28| 26| 37| 121| 146| 1 --------------------------------------------------------------------------- 121- 146 (47.01/23.07) DFLVK.VGTVTMG.PSARGISVEVEYGP 159- 186 (41.28/19.68) EFLQSfLGSHTPGaPAVFGNRHDAVYGP --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab