<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31533
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTPQPHNGAPGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHAKHNDIFEPMDTVKQYLEQFTNYRKHVTLMGGMGSGPGSQQVGPNVHMSPAVAGLHRS |
Length | 252 |
Position | Head |
Organism | Drosophila melanogaster (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.096 |
Instability index | 43.22 |
Isoelectric point | 7.18 |
Molecular weight | 27861.88 |
Publications | PubMed=10731132
PubMed=12537572
PubMed=11259581
PubMed=12021283
PubMed=16751183
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Required for activated
transcription of the MtnA gene.
ECO:0000269 PubMed:11259581
ECO:0000269 PubMed:12021283
ECO:0000269 PubMed:16751183
|
GO - Cellular Component | mediator complex GO:0016592 IDA:FlyBase
nucleus GO:0005634 IDA:FlyBase
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IEA:GOC
regulation of transcription by RNA polymerase II GO:0006357 IDA:FlyBase
|
Interaction
Repeat regions
Repeats |
>MDP31533
No repeats found
No repeats found
|