<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31530
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVTQVPVLEGKSVQQTVELLSKKLELLGAEKHGAFGVDCETYHTAAAISSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADANFDTLMVKLKGFFQNAKANKIESRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPGIPSVFGTKHDSIYSPADTMVQYMELFNKIRKQQQVPVAGIR |
Length | 211 |
Position | Head |
Organism | Gallus gallus (Chicken) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.011 |
Instability index | 28.63 |
Isoelectric point | 6.51 |
Molecular weight | 23288.70 |
Publications | PubMed=15642098
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.35| 20| 37| 126| 145| 1
---------------------------------------------------------------------------
126- 145 (38.15/22.15) GTVTMG.PSARGISVEVEYCP
165- 185 (35.20/20.01) GSHTPGiPSVFGTKHDSIYSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.43| 23| 41| 2| 24| 2
---------------------------------------------------------------------------
2- 24 (38.59/29.54) GVTCVTQVPVLEGKSVQQTVELL
40- 62 (40.84/31.65) GVDCETYHTAAAISSQGQTGKLM
---------------------------------------------------------------------------
|