<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31529
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MSSAVIFVESATPGTLTEFKDLLAKQLLEVRETWSLEFRTYRTLVKDFPSREKLLYSLTFPHHDKKTVLIRNSLAWVLGTAEIPDNLQTCSTGLSESIDQLLASKLSNMWAQRQVIRGDAGQTLLITGDVTVRIINLFAATGFKGLLIELDNLQSATSLANITDLLNEMKVKVFKVASAPGLKSEDVEVVDSSSTMESGNEALFTLAKQYIEVLE |
Length | 215 |
Position | Head |
Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Nakaseomyces>
Nakaseomyces/Candida clade.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.051 |
Instability index | 29.18 |
Isoelectric point | 5.09 |
Molecular weight | 23786.03 |
Publications | PubMed=15229592
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi
TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31529
No repeats found
|