<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31526
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MKRTAVIFIEKATPSTITQFHDILSTHVLAIQEKWSFELKTFRSSIKNLPPSDTKVLYSLQLTHRDNQTVVIKNQSAIVTGQHSTDALTSNGCSSGFPEPFDNILTSKLSNIWTQRQSTKGNFGTTYKTSELIIRASNVFSSSGFKGLLLEIECTDPVSAEEFDRRVANIRAMLSEIDINDYKLNKDEMNEGKPVFLCDLAYQYVKVLD |
| Length | 209 |
| Position | Head |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.296 |
| Instability index | 49.15 |
| Isoelectric point | 6.43 |
| Molecular weight | 23535.43 |
| Publications | PubMed=15001715
PubMed=23749448
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi
TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP31526
No repeats found
|