| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE |
| Length | 220 |
| Position | Head |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Saccharomyces. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -1.001 |
| Instability index | 52.34 |
| Isoelectric point | 5.96 |
| Molecular weight | 24857.04 |
| Publications | PubMed=1656237 PubMed=7502586 PubMed=7813418 PubMed=24374639 PubMed=17322287 PubMed=8995225 PubMed=11555651 PubMed=14562095 PubMed=14562106 PubMed=15175151 PubMed=15477388 PubMed=16002404 PubMed=16076843 PubMed=16263706 PubMed=16630888 PubMed=17192271 PubMed=12191485 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors. The Mediator complex unfolds to an extended
conformation and partially surrounds RNA polymerase II, specifically
interacting with the unphosphorylated form of the C-terminal domain
(CTD) of RNA polymerase II. The Mediator complex dissociates from the
RNA polymerase II holoenzyme and stays at the promoter when
transcriptional elongation begins.
ECO:0000269 PubMed:11555651 ECO:0000269 PubMed:16076843 ECO:0000269 PubMed:16263706 ECO:0000269 PubMed:17192271 |
| GO - Cellular Component | core mediator complex GO:0070847 IDA:SGD mediator complex GO:0016592 IBA:GO_Central nucleus GO:0005634 IDA:SGD |
| GO - Biological Function | transcription coactivator activity GO:0003713 IMP:SGD transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | F:transcription coactivator activity GO:0003713 IMSGD negative regulation of transcription by RNA polymerase II GO:0000122 IMSGD positive regulation of transcription by RNA polymerase II GO:0045944 IMSGD regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central RNA polymerase II preinitiation complex assembly GO:0051123 IMSGD transcription open complex formation at RNA polymerase II promoter GO:0001113 IMSGD |
| Binary Interactions |
| Repeats |
>MDP31513
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 147.45| 48| 124| 20| 83| 1
---------------------------------------------------------------------------
26- 83 (63.70/57.67) QQPNPLQDLisVYGLDDISRQVARTNlDGTKAvklrKSYKNQiadLSGKFSTIPTREN
162- 209 (83.74/38.16) QAPFDIDDL..AFDLDGTGKSQSGSN.SGNNS....KKRKNK...SSGSSMATPTHSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.97| 10| 23| 97| 106| 2
---------------------------------------------------------------------------
97- 106 (21.97/13.90) NPDM.MIQPPQ
122- 132 (16.01/ 8.41) NRDIaLFQPPN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PFDIDDLAFDLD 2) PSYYYY | 164 11 | 175 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab