<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31511
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MEGFSGLFAASEPSSIPSAPGPPSVVPTCTGAFVSGKTQTSTPTVPGPPLPIPPPLSSSSSGEDSSRRPAAGPFYILRELPGLSDLTGSVNLILHYNLEHSFSKFCGKKMKEKLSNFLPDLPGMIDTPGAQDNSSLRSLIEKPPICGNSFTPLTGALLTGFRLHTGPLPEQCRLMHIQPPKKKNKKHKQSRTQEPAPPETPSDSDHRKKKKKQREDDPERRRKKKDKKKKKSRHSPEHPGAGSSQSGLR |
| Length | 249 |
| Position | Head |
| Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Silurana.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.878 |
| Instability index | 73.98 |
| Isoelectric point | 9.90 |
| Molecular weight | 27007.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31511
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.64| 27| 39| 181| 207| 1
---------------------------------------------------------------------------
181- 207 (50.57/22.13) KKKNKKHKQSRTQEPAPPETPSDSDHR
223- 249 (49.07/21.28) KKKDKKKKKSRHSPEHPGAGSSQSGLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.45| 22| 23| 6| 27| 2
---------------------------------------------------------------------------
6- 27 (41.76/15.44) GLFAASE.PSSIPSAPGPPSVVP
31- 53 (38.68/13.85) GAFVSGKtQTSTPTVPGPPLPIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.11| 12| 38| 77| 88| 3
---------------------------------------------------------------------------
77- 88 (20.01/11.32) LRELPGLSDLTG
98- 107 (16.85/ 8.37) LEH..SFSKFCG
118- 129 (21.24/12.48) LPDLPGMIDTPG
---------------------------------------------------------------------------
|