<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31510
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MAQAPEYHYVGSVDYQPTRPSAHQNLIELYGLTELAKKVGRVDEFGNKRKMRRSYKAYIQDLPGYNEILRDNTIKQWLTNPIREEVPIDIEFLHHVFSVEPGIIPGFNPKVFGLEDDVVMGNVSRDSSQPRSPSRRKK |
| Length | 138 |
| Position | Head |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.707 |
| Instability index | 67.34 |
| Isoelectric point | 8.83 |
| Molecular weight | 15927.89 |
| Publications | PubMed=11859360
PubMed=11572939
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
cytosol GO:0005829 HDA:PomBase
mediator complex GO:0016592 IDA:PomBase
nucleus GO:0005634 HDA:PomBase
F:transcription coactivator activity GO:0003713 IPomBase
P:positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IPomBase
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IC:PomBase
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IC:PomBase
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31510
No repeats found
|